DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG30087

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:213 Identity:60/213 - (28%)
Similarity:95/213 - (44%) Gaps:26/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQ-------HVDLEVLNIVSHEQFNRF 116
            ||::|...:|||||.:..    :|.:|.||.:..|..|.|       ..:..::..::|..:|..
  Fly    69 GSILNSRYILTAAHCVFP----NLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAA 129

  Fly   117 NAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFN-GWGKVYLNSTDYPTVLKTVQVDL 180
            |..|::|||.|..:.....:|..|.:.|..|.....:.:.. |||:...|.  :|.:|:|.::..
  Fly   130 NHVNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNG--FPHLLQTAELRA 192

  Fly   181 LSMGMCS---SRKLPIQQICGKGLEGIDCSGDGGAPLVCRI-LTYPYKYAQVGIVNW---LSQKP 238
            .....||   ...:...|||....|...|:||.|.|||.|: .....:|.|:|||::   ..|.|
  Fly   193 YDAAYCSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSP 257

  Fly   239 VENTFIVFTNVAGLLPWI 256
            .     |:|.|...:.||
  Fly   258 G-----VYTYVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 60/213 (28%)
Tryp_SPc 39..256 CDD:214473 58/211 (27%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 58/211 (27%)
Tryp_SPc 42..272 CDD:238113 60/213 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.