DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG30002

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:240 Identity:67/240 - (27%)
Similarity:101/240 - (42%) Gaps:35/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTK-YDLVVRAGEWDTSTTADQQHVDLE 103
            ||:..:....|......| ||||:...||||||......: .::.|..||.|.|:|:|....:.|
  Fly    74 PWMAFLHIASDLEMCRCG-GSLISELFVLTAAHCFKMCPRSKEIRVWLGELDLSSTSDCTTYNYE 137

  Fly   104 -----------VLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEA----GIQKGS 153
                       :...:.||:||.|....::||:.|........:|..|.|.|.:.    .:|.|.
  Fly   138 RVCAPPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQ 202

  Fly   154 CFFN-GWGKV----YLNSTDYPTVLKTVQVDLLSMGMCSSRKLPIQQICGKGLEGID-CSGDGGA 212
            .|.. ||||.    |.||        |::||:.:......|....  :|..| :.:| |:||.|.
  Fly   203 RFMAVGWGKTESLRYANS--------TMEVDIRTEKCTDGRDTSF--LCASG-DYVDTCNGDSGG 256

  Fly   213 PLVCRILTYPYKYA-QVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            ||:.:...:....| |.|:|:..||.........:.:|...:|||
  Fly   257 PLLWKTTLFGKDRAVQFGVVSTGSQNCGAGHKAYYMDVPTYMPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 67/240 (28%)
Tryp_SPc 39..256 CDD:214473 65/238 (27%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 65/238 (27%)
Tryp_SPc 62..301 CDD:238113 65/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.