DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Prss42

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_694739.1 Gene:Prss42 / 235628 MGIID:2665280 Length:335 Species:Mus musculus


Alignment Length:247 Identity:72/247 - (29%)
Similarity:109/247 - (44%) Gaps:55/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGV--GSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVD 101
            :||.|||      ..|::.|  |||||...||||||.:....:|:  |:.|  |.|.......:.
Mouse    90 WPWQVSV------RVRHMHVCGGSLINSQWVLTAAHCIYSRIQYN--VKVG--DRSVYRQNTSLV 144

  Fly   102 LEVLNIVSHEQFN-RFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGS-CFFNGWGKVYL 164
            :.:..|..|.:|: ....:|::|||.|......|.||..:.:..:...::.|: |:..||||:..
Mouse   145 IPIKTIFVHPKFSTTIVVKNDIALLKLQHPVNFTTNIYPVCIPSESFPVKAGTKCWVTGWGKLVP 209

  Fly   165 NSTDYPT-VLKTV--------------------QVDLLSMGMCSSRKLPIQQICGKGLEGID-CS 207
            .:.|.|| :|:.|                    .|||:..||          :||....|.| |.
Mouse   210 GAPDVPTEILQEVDQNVILYEECNEMLKKATSSSVDLVKRGM----------VCGYKERGKDACQ 264

  Fly   208 GDGGAPLVCRILTYPYKYAQVGIVNW---LSQKPVENTFIVFTNVAGLLPWI 256
            ||.|.|:.|.   :..|:.|||:|:|   ..:|....   |:|:||....|:
Mouse   265 GDSGGPMSCE---FENKWVQVGVVSWGISCGRKGYPG---VYTDVAFYSKWL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 72/247 (29%)
Tryp_SPc 39..256 CDD:214473 71/245 (29%)
Prss42NP_694739.1 Tryp_SPc 78..309 CDD:214473 71/244 (29%)
Tryp_SPc 79..310 CDD:238113 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.