Sequence 1: | NP_001259904.1 | Gene: | CG4259 / 33385 | FlyBaseID: | FBgn0031389 | Length: | 270 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036349.1 | Gene: | TPSD1 / 23430 | HGNCID: | 14118 | Length: | 242 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 62/206 - (30%) |
---|---|---|---|
Similarity: | 91/206 - (44%) | Gaps: | 33/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 PRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQH 99
Fly 100 VD-----LEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKG-SCFFNG 158
Fly 159 WGKVYLN---STDYPTVLKTVQVDLLSMGMC------------SSRKLPIQQICGKGLEGID-CS 207
Fly 208 GDGGAPLVCRI 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4259 | NP_001259904.1 | Tryp_SPc | 39..259 | CDD:238113 | 60/202 (30%) |
Tryp_SPc | 39..256 | CDD:214473 | 60/202 (30%) | ||
TPSD1 | NP_036349.1 | Tryp_SPc | 38..242 | CDD:238113 | 62/206 (30%) |
Tryp_SPc | 38..240 | CDD:214473 | 62/206 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152849 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |