DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Tmprss13

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006510195.1 Gene:Tmprss13 / 214531 MGIID:2682935 Length:561 Species:Mus musculus


Alignment Length:253 Identity:67/253 - (26%)
Similarity:110/253 - (43%) Gaps:48/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGV-----GSLINPNVVLTAAH--------ILNGTTKYDLVVRAGEWD 90
            :||.||:         :.|.     |:||:...||||||        :|.|...|     ||   
Mouse   331 WPWQVSL---------HFGTTHICGGTLIDAQWVLTAAHCFFVTREKLLEGWKVY-----AG--- 378

  Fly    91 TSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANIN--LIPLYLQEAGIQKGS 153
             ::...|......:..|:.:..:.....:.::||:.|.....::|:|:  .:|::.|..|:.: :
Mouse   379 -TSNLHQLPEAASISQIIINGNYTDEQDDYDIALIRLSKPLTLSAHIHPACLPMHGQTFGLNE-T 441

  Fly   154 CFFNGWGKVYLNSTDYPT--VLKTVQVDLLSMGMCS-----SRKLPIQQICGKGLEG--IDCSGD 209
            |:..|:||.  ..||..|  .|:.|||:|:....|:     ...|..:.:|...|.|  ..|.||
Mouse   442 CWITGFGKT--KETDEKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDLRGGRDSCQGD 504

  Fly   210 GGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLRLEANFR 267
            .|.||||.   ...::...|:.:|.:....:|...|:|.|..:||||...:..|..||
Mouse   505 SGGPLVCE---QNNRWYLAGVTSWGTGCGQKNKPGVYTKVTEVLPWIYRKMESEVRFR 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/243 (26%)
Tryp_SPc 39..256 CDD:214473 62/240 (26%)
Tmprss13XP_006510195.1 PHA03378 <6..>122 CDD:223065
LDLa <204..220 CDD:238060
SRCR_2 225..314 CDD:373897
Tryp_SPc 319..548 CDD:214473 62/240 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.