DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and try-1

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:249 Identity:67/249 - (26%)
Similarity:101/249 - (40%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SNPRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHIL---NGTTKYDLVVRAGEWDTSTT 94
            |:|. ::||.|.:|.:   |..:...||||:||.||||||..   ...|.|.  ||.|...:.:.
 Worm    64 SSPH-SWPWTVQLLSR---LGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYS--VRVGGHRSGSG 122

  Fly    95 ADQQHVDLEVLNIVSHEQFN-RFNAENNMALLILVSAFEMTANINLIPLYLQE-AGIQKGSCFFN 157
            :..:     |..:..|..:| .|.:..:.|::.:......:....  |:.|.. ..::...|...
 Worm   123 SPHR-----VTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTAR--PICLPSLPAVENRLCVVT 180

  Fly   158 GWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSR-------KLPIQQICGKGLEGID-CSGDGGAPL 214
            |||.....|:.....|:.:.|.|||...|||.       .||.....|.....|| |.||.|.||
 Worm   181 GWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPL 245

  Fly   215 VCRILTYPYKYAQVGIVNW---LSQKPVENTFIVFTNVAGLLPWIDYHLRLEAN 265
            :|   .....:...|:|:|   .::..:..   |:.||.....||:    ||.|
 Worm   246 MC---ARDGHWELTGVVSWGIGCARPGMPG---VYGNVHSASTWIN----LEMN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 62/235 (26%)
Tryp_SPc 39..256 CDD:214473 60/232 (26%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 63/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.