DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG12256

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:284 Identity:81/284 - (28%)
Similarity:120/284 - (42%) Gaps:42/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YFAFL---TTLIISLVNS----------QYF---NYNQIRRETYGSN-PRATF-PWVVSV-LDQR 49
            ||..|   |.|.:..|.|          :||   :.|...|...|.: |...: |:.||: ...|
  Fly     6 YFVLLLSSTLLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQFLTR 70

  Fly    50 DWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFN 114
            ....|:...||||.||.||||||.:||.....:.|.||..|.:   |......:|.:...:|.:.
  Fly    71 SGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLN---DSSGFRSQVQSYEMNENYQ 132

  Fly   115 RFNAENNMALLILVSAFEM-TANINLIPLYLQEAGIQKGSCFFNGWGKVYLNST----DYPTVLK 174
            .. ..:::|:|.:...||: ...::.|.:...:...........|||.|:...|    .|||||:
  Fly   133 EL-VTSDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQ 196

  Fly   175 TVQVDLLSMGMC--SSRKLPIQQIC-----GKGLEGIDCSGDGGAPLVCRILTYPYKYAQVGIVN 232
            .:....||...|  :..:|...:||     |||.    |:||.|.|||   :.....|.|||:|:
  Fly   197 KLDYKTLSNSKCKETMTQLTDTEICALERFGKGA----CNGDSGGPLV---MKSGESYKQVGVVS 254

  Fly   233 WLSQKPVENTFIVFTNVAGLLPWI 256
            :.:.....|...|:|.|:....||
  Fly   255 YGTAFCASNNPDVYTRVSMFDGWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 68/232 (29%)
Tryp_SPc 39..256 CDD:214473 66/230 (29%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 69/242 (29%)
Tryp_SPc 47..280 CDD:238113 70/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.