DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and AgaP_AGAP001964

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_321098.5 Gene:AgaP_AGAP001964 / 1281159 VectorBaseID:AGAP001964 Length:363 Species:Anopheles gambiae


Alignment Length:258 Identity:78/258 - (30%)
Similarity:114/258 - (44%) Gaps:39/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RETYGSNPRATFPWVVSVLD-QRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDT 91
            |..||.     |||:..|.. |.|:.. |:..|:|::..||:|.||.:...|..:|.||.||||.
Mosquito   116 RAKYGE-----FPWMAFVYTAQADYEL-YLCGGTLVHSKVVITIAHCIENRTASELRVRLGEWDL 174

  Fly    92 STTADQQHV-------DLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGI 149
                  :|:       |..|:..|:|.||......|::|:|.|....:.|..:.:..|..|.|..
Mosquito   175 ------EHMVEIYPPQDRAVIAAVTHPQFYSELLLNDIAILFLDEHVDFTEVVGIACLPPQNANF 233

  Fly   150 QKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCS--------SRKLPIQQ--ICGKGLEGI 204
            ....|.|.|||:.......  :|||..::.::..|.|.        :|...:.|  :|..|..|.
Mosquito   234 DHKRCLFTGWGEDERGRNS--SVLKRTKLPIVPNGQCQRVLRRHLLNRSFRLHQGFLCAGGESGK 296

  Fly   205 D-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWID------YHL 260
            | |.||||:||||.|.....:|..||:|.:..:...:....|:.||.....|||      ||:
Mosquito   297 DACRGDGGSPLVCPIPQSENQYYVVGLVAFGYECGTQGVPGVYVNVPHYRDWIDGEIEKMYHV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 73/244 (30%)
Tryp_SPc 39..256 CDD:214473 70/235 (30%)
AgaP_AGAP001964XP_321098.5 Tryp_SPc 117..350 CDD:238113 73/246 (30%)
Tryp_SPc 117..349 CDD:214473 72/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.