DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CLIPA5

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_320729.4 Gene:CLIPA5 / 1280861 VectorBaseID:AGAP011787 Length:397 Species:Anopheles gambiae


Alignment Length:250 Identity:87/250 - (34%)
Similarity:122/250 - (48%) Gaps:23/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GSNPRATFPWVVSV-----LDQRDWLFR-YIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWD 90
            |.:....|||:|:|     :|..|.:.. |...||:|.|||||||||.:....|..|::||||||
Mosquito   134 GESHYGEFPWMVAVMLSSPMDNSDSILNVYQCGGSVIAPNVVLTAAHCVFNKPKTQLLLRAGEWD 198

  Fly    91 TSTTAD-QQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAG--IQKG 152
            |.|..: ..|.:..|..::.||.|:..:..|::|||.|...|::..|:.  |:.|..:|  ....
Mosquito   199 TQTEHELYMHQNRRVAEVILHEAFDNESLANDVALLTLAEPFQLGENVQ--PICLPPSGTSFDYQ 261

  Fly   153 SCFFNGWGK-VYLNSTDYPTVLKTVQVDLLSMGMCSSRK----------LPIQQICGKGLEGID- 205
            .||.:|||| .:.....|..:||.|::.::....|....          |....:|..|:.|.| 
Mosquito   262 HCFASGWGKDQFGKEGKYQVILKKVELPVVPHAKCQETMRSQRVGNWFVLDQSFLCAGGVAGQDM 326

  Fly   206 CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHL 260
            |.||||:||||.|...|..|.|.|||.|......:....|:.:||.|..|||..|
Mosquito   327 CRGDGGSPLVCPIPGSPTHYYQAGIVAWGLGCGEDGIPGVYGDVAFLRDWIDQQL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 85/240 (35%)
Tryp_SPc 39..256 CDD:214473 82/237 (35%)
CLIPA5XP_320729.4 Tryp_SPc 135..380 CDD:238113 85/246 (35%)
Tryp_SPc 135..377 CDD:214473 82/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.