DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CLIPA2

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_320727.4 Gene:CLIPA2 / 1280859 VectorBaseID:AGAP011790 Length:503 Species:Anopheles gambiae


Alignment Length:278 Identity:71/278 - (25%)
Similarity:120/278 - (43%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NYNQIRRETYGSNPRA---TFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILN--GTTKYD 81
            |.|.:.:.|...:.||   .|||:|::....:.  ||...|:||:|..:||.||.:.  |....:
Mosquito   229 NLNGVVQRTINEDFRAEYGEFPWMVALFQLPEQ--RYCCNGALIDPKAILTTAHCVTNCGGRAAN 291

  Fly    82 LVVRAGEWDTSTTADQ--QHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLI---- 140
            ::||.|||:.|:|.:.  ...|:.|.::..|.:::.....||:|:|.|....:..|.|..:    
Mosquito   292 IMVRFGEWNMSSTHEMAIPREDIGVKSVHQHPRYSPSALLNNIAVLELAHPVQYQATIQPVCLPS 356

  Fly   141 ---PLYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPIQQ------- 195
               ||...|      :....|||:|...:.....:||.:.:..:...:|......:::       
Mosquito   357 ANQPLRAME------NMIATGWGRVMEENAPPTQILKRLDLQRMEPSICREALRRVRRPYPFILD 415

  Fly   196 ---IC---GKGLEGIDCSGDGGAPLVCRILTYPYKYAQVGIVNW---LSQKPVENTFIVFTNVAG 251
               :|   ..|.:...|.||.|||:|..:.....:|...|:|:|   ..||.:..|  |.|.|..
Mosquito   416 SSFVCSTTNHGDQERPCDGDAGAPVVVELPGTTNRYYLHGLVSWGYGCHQKQIPYT--VLTKVVH 478

  Fly   252 LLPWIDYHLRLEANFRPR 269
            ...|||   |:...|:.:
Mosquito   479 FREWID---RIVLGFKKK 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/246 (26%)
Tryp_SPc 39..256 CDD:214473 61/243 (25%)
CLIPA2XP_320727.4 Tryp_SPc 244..486 CDD:238113 65/254 (26%)
Tryp_SPc 244..483 CDD:214473 62/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.