DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and AgaP_AGAP011793

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_320722.4 Gene:AgaP_AGAP011793 / 1280855 VectorBaseID:AGAP011793 Length:426 Species:Anopheles gambiae


Alignment Length:254 Identity:90/254 - (35%)
Similarity:126/254 - (49%) Gaps:17/254 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QIRRETYGSNPRATFPWVVSVLDQRDWLFRYIGV----GSLINPNVVLTAAHILNGTTKYDLVVR 85
            :|..::.|.:....|||:.::|:::..|.:.|..    ||||:|:|:|||||.:...|...|.||
Mosquito   159 RITDDSDGESEYGEFPWMAAILEEQKALDQIINTYMCGGSLIHPSVILTAAHCVQNITITALKVR 223

  Fly    86 AGEWDTSTTADQ-QHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGI 149
            .|||||.:..:. .|.|..|:.|..||||....|.||:|||.|....|:...:|.|.|.......
Mosquito   224 LGEWDTRSWKEPFPHQDRRVVEIAFHEQFFAPAALNNVALLFLDKPVELMETVNTICLPPANYTF 288

  Fly   150 QKGSCFFNGWGK-VYLNSTDYPTVLKTVQVDLLSMGMCS--------SRKLPIQQ--ICGKGLEG 203
            ....|..:|||| |:.|...:..:||.|::.|:..|.|.        .|:..:.:  :|..|.:|
Mosquito   289 DPVRCVASGWGKDVFGNEGMFQAILKKVELPLMPRGACQRALRMTRLGRRFKLHESFLCAGGEKG 353

  Fly   204 ID-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLR 261
            .| |.||||:||||.|......|.|..||.|.....:|....|:.|||....|||..||
Mosquito   354 RDTCKGDGGSPLVCPIPGVANGYYQASIVAWGINCGIEGVPGVYVNVALFREWIDEQLR 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 86/236 (36%)
Tryp_SPc 39..256 CDD:214473 83/233 (36%)
AgaP_AGAP011793XP_320722.4 Tryp_SPc 167..410 CDD:238113 86/242 (36%)
Tryp_SPc 167..407 CDD:214473 83/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24258
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.