DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and AgaP_AGAP011794

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_320721.3 Gene:AgaP_AGAP011794 / 1280854 VectorBaseID:AGAP011794 Length:154 Species:Anopheles gambiae


Alignment Length:120 Identity:43/120 - (35%)
Similarity:57/120 - (47%) Gaps:12/120 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 CFFNGWGK-VYLNSTDYPTVLKTVQVDLLSMGMCS--------SRKLPIQQ--ICGKGLEGID-C 206
            |..:|||| |:.|......::|.|::.|:..|.|.        .|:..:.:  :|..|.:|.| |
Mosquito    21 CVASGWGKDVFGNEGMLQVIMKKVELPLVPRGACQRALRTTHLGRQFKLHESFVCAGGEKGRDTC 85

  Fly   207 SGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLR 261
            .||||:||||.|......|.|.|||.|......|....|:.|||....|||..||
Mosquito    86 KGDGGSPLVCPIPGVANGYYQAGIVAWGIDCGKEGIPGVYVNVALFREWIDEQLR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 41/116 (35%)
Tryp_SPc 39..256 CDD:214473 38/113 (34%)
AgaP_AGAP011794XP_320721.3 Tryp_SPc <2..138 CDD:238113 41/116 (35%)
Tryp_SPc <2..135 CDD:214473 38/113 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.