DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CLIPB11

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_319991.3 Gene:CLIPB11 / 1280172 VectorBaseID:AGAP009214 Length:359 Species:Anopheles gambiae


Alignment Length:258 Identity:77/258 - (29%)
Similarity:117/258 - (45%) Gaps:38/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RETYGSNPRA-TFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHIL--NGTTKYDLVVRAGEW 89
            |..:|.:.|. .:|| :::|.||  ...::..|:|||...||||||.:  |..|    .||.||:
Mosquito   113 RIAFGQDARLFQYPW-MALLKQR--AGNFVCGGTLINERYVLTAAHCIKNNDIT----TVRLGEF 170

  Fly    90 DTSTTAD-----QQHV----DLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQ 145
            |.||..|     :|..    ||.|...:.||.::....||::.|:.|  |.|...|.|::|:.|.
Mosquito   171 DLSTPIDCDKRGEQCAPPPQDLFVEQTIVHEAYSARRKENDIGLVRL--AKEAEYNDNVLPICLP 233

  Fly   146 EAGIQK---GSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPI--------QQICGK 199
            .....:   .:.|..|||..  .|......|:..::.|||...|..:.|.:        .|:|..
Mosquito   234 VTPAMRTTQTTYFVAGWGAT--ESAPSSNRLQFTKLSLLSNDQCVQKLLRVDSFAKVNNDQMCAI 296

  Fly   200 GLEGID-CSGDGGAPLVCRILTYPYKYAQVGIVNW-LSQKPVENTFIVFTNVAGLLPWIDYHL 260
            |....| |:||.|.||  :.::...:|.|.|:|:: |.....::...|:|.|.....||..||
Mosquito   297 GANLTDNCTGDSGGPL--KTISINARYVQYGVVSYGLRTCGKQSAPGVYTRVENYADWILEHL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 72/243 (30%)
Tryp_SPc 39..256 CDD:214473 70/240 (29%)
CLIPB11XP_319991.3 Tryp_SPc 113..353 CDD:214473 73/252 (29%)
Tryp_SPc 117..356 CDD:238113 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.