DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and AgaP_AGAP006087

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_316143.4 Gene:AgaP_AGAP006087 / 1276758 VectorBaseID:AGAP006087 Length:342 Species:Anopheles gambiae


Alignment Length:172 Identity:53/172 - (30%)
Similarity:76/172 - (44%) Gaps:22/172 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GSLINPNVVLTAAHILNGTTK-YDLVVRAG---EWDTSTTADQQHVDLEVLNIVSHEQFNRFNAE 119
            ||||..:.||||:|..  ||| .::||.||   .:|.|....|:    .||..:||..::.....
Mosquito    99 GSLITASRVLTASHCF--TTKPSNMVVVAGVLNRFDRSKRMQQR----RVLRYLSHPGWHARTLA 157

  Fly   120 NNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLNSTD--YPTVLKTVQVDLLS 182
            .::.|:.|||.|:....:..|.| .....:....|...|||:.......  .|..|:...|.:|.
Mosquito   158 ADIGLVALVSPFQCGGGVQPIAL-ANRPPVDGEPCTIYGWGQTEEGRKQRFQPVCLQKASVSVLG 221

  Fly   183 MGMCSSRKL------PIQQICGKGLE-GID-CSGDGGAPLVC 216
            :..| :|.|      |...:|....: |:| |.||.|.||||
Mosquito   222 LERC-NRSLHTVVTVPDGTLCAGSFDGGVDSCQGDSGGPLVC 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 53/172 (31%)
Tryp_SPc 39..256 CDD:214473 53/172 (31%)
AgaP_AGAP006087XP_316143.4 Tryp_SPc 62..297 CDD:214473 53/172 (31%)
Tryp_SPc 63..297 CDD:238113 53/172 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.