DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CLIPB13

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_314336.2 Gene:CLIPB13 / 1275070 VectorBaseID:AGAP004855 Length:410 Species:Anopheles gambiae


Alignment Length:283 Identity:73/283 - (25%)
Similarity:116/283 - (40%) Gaps:60/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IRRETYGSNPRA-TFPWVVSVLDQRDWLFRY--IGV------GSLINPNVVLTAAHILNGTTKYD 81
            :.|..:|:..|. .:||:|        |.||  .||      |||||...||||||.:..::...
Mosquito   148 VNRIAHGNTTRVFEYPWMV--------LLRYESNGVLSDRCGGSLINNRYVLTAAHCVRTSSSIR 204

  Fly    82 LV-VRAGEWDTSTTAD------------QQHVDLEVLNIVSHEQFNR-FNAENNMALLILVSAFE 132
            || ||.||.|.....|            ...||:::.:::.|:.:|| ....:::|||.:....|
Mosquito   205 LVKVRLGEHDKRQQIDCHVYSDGEKDCADPAVDVDIESMIVHKDYNRPIKFRHDIALLRMAQEVE 269

  Fly   133 MTANINLIPLYLQEAGIQK--GSCFFNGWG------------KVYLNSTDYPTVLKTVQVDLLSM 183
            .:.::..|.|.:.|...:|  ......|||            :..:|....|...:.:..:.|.:
Mosquito   270 FSDSVKPICLPVNEDVRRKVLPKYIITGWGTTEQQSLSDLLLQAIVNHVPVPECQQKMNENFLYV 334

  Fly   184 GMCSSRKLPIQQICGKGLEGI--DCSGDGGAPLVCRILTYPYKYAQVGIVN-WLSQKPVENTFIV 245
            .:...     .|:|..| ||:  .|.||.|.||...:.....|:.|.|||: .:.....|:...:
Mosquito   335 TLADE-----WQMCAAG-EGLVDSCQGDSGGPLGFSVDVAGAKFVQFGIVSAGVRSCGKESVPGI 393

  Fly   246 FTNVAGLLPWIDYHLRLEANFRP 268
            :|.|...:.||      .||.:|
Mosquito   394 YTRVTSYMNWI------VANMKP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 67/258 (26%)
Tryp_SPc 39..256 CDD:214473 65/255 (25%)
CLIPB13XP_314336.2 CLIP 28..81 CDD:288855
Tryp_SPc 150..404 CDD:214473 68/267 (25%)
Tryp_SPc 151..404 CDD:238113 67/266 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.