DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CLIPB2

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_312956.3 Gene:CLIPB2 / 1273920 VectorBaseID:AGAP003246 Length:355 Species:Anopheles gambiae


Alignment Length:260 Identity:77/260 - (29%)
Similarity:118/260 - (45%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVL-----DQRDWLFRYIGVGSLINPNVVLTAAHI---------LNGTTKYDLVVRAGEW 89
            |||...:.     :|.|:   :.| |:|||...:|||||.         |||       ||.|||
Mosquito   114 FPWTALIEYRKPGNQYDF---HCG-GALINARYILTAAHCVQSLPRGWQLNG-------VRLGEW 167

  Fly    90 DTSTTADQQH-------VDLEVLNIVSHEQFNRFNA--ENNMALLIL---VSAFEMTANINLIPL 142
            |.||..|...       :|||:.:.|:|..::..:.  .|::||:.|   |::.||...|.|...
Mosquito   168 DLSTANDCSDGICSAGPIDLEIESFVAHAGYDAADTAHTNDIALIRLRQDVASSEMIRPICLPLT 232

  Fly   143 YLQEAGIQKGS-CFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRK--------LPIQQICG 198
            ..|.:..:.|: .|..||||....|...    :.::|:|........|:        |...|:|.
Mosquito   233 EPQRSRNRVGTVSFAAGWGKTESASASE----RKLKVELTVQDPSRCRQIYRGINIALKASQMCA 293

  Fly   199 KGLEGID-CSGDGGAPLVCRILTYPYKYAQVGIVNW-LSQKPVENTFIVFTNVAGLLPWIDYHLR 261
            .||:|.| |:||.|.||:.:.....|   .:|:|:: ||:........|:|||...|.||:.:::
Mosquito   294 GGLQGKDTCTGDSGGPLMAKSAGAWY---LIGVVSFGLSKCGTAGYPGVYTNVVEYLDWIESNVQ 355

  Fly   262  261
            Mosquito   356  355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 77/256 (30%)
Tryp_SPc 39..256 CDD:214473 75/253 (30%)
CLIPB2XP_312956.3 CLIP 26..78 CDD:288855
Tryp_SPc 102..350 CDD:214473 75/253 (30%)
Tryp_SPc 103..353 CDD:238113 77/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.