DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and AgaP_AGAP002842

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_312070.5 Gene:AgaP_AGAP002842 / 1273118 VectorBaseID:AGAP002842 Length:282 Species:Anopheles gambiae


Alignment Length:238 Identity:66/238 - (27%)
Similarity:104/238 - (43%) Gaps:46/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LDQRDWLFRYIGVGSLINPNVVLTAAHILN-GTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVS 109
            :|..:|   :.| |:||:...||||||..: |.:....||:.|..|....|    :.:.|.::|.
Mosquito    56 VDGYEW---FCG-GTLISDRFVLTAAHCAHTGMSHPPTVVQLGAHDLRRPA----LYVGVRDVVL 112

  Fly   110 HEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLNSTDYPT-VL 173
            |..:....|.|::||:.|.|  .:.::|....|:..|...:.......||||  |...:.|: :|
Mosquito   113 HPGYGGVLAYNDIALIRLES--PVASSIQPALLWRSETIPENVPLIATGWGK--LGHFEDPSMIL 173

  Fly   174 KTVQVDLLSMGMCS-----SRK-----LPIQQICGKGLEGID-CSGDGGAPLVCRI-----LTYP 222
            :.||:.::....|:     ||:     ||.|...|....|.| |.||.|.||..::     :...
Mosquito   174 QRVQIPIVPNSQCNQLLYRSRRLRHGVLPSQLCAGDPNGGKDTCEGDSGGPLQLKLPSARPIGQA 238

  Fly   223 YKYAQVGIVNWLSQKPVENTFI--------VFTNVAGLLPWID 257
            |:|..|||.:        |..|        ::|.|:....|||
Mosquito   239 YRYYVVGITS--------NGGICGTVDRPGLYTRVSSYAGWID 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 66/238 (28%)
Tryp_SPc 39..256 CDD:214473 63/235 (27%)
AgaP_AGAP002842XP_312070.5 Tryp_SPc 26..275 CDD:238113 66/238 (28%)
Tryp_SPc 26..272 CDD:214473 63/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.