DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and AgaP_AGAP000290

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_310831.5 Gene:AgaP_AGAP000290 / 1271969 VectorBaseID:AGAP000290 Length:499 Species:Anopheles gambiae


Alignment Length:237 Identity:70/237 - (29%)
Similarity:104/237 - (43%) Gaps:25/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQ-RDWLFRYIGVGSLINPNVVLTAAHILNGTTKYD--LVVRAGEWDTSTTADQ-QH 99
            |||.|::... |:..:.|...|:|:|.:||:||||.::....:.  .||.||:||...|.:: .|
Mosquito   266 FPWTVAIHQLIRNGSYVYHCGGALLNQSVVVTAAHCVSNNRLHPNRFVVYAGDWDRRHTQERLPH 330

  Fly   100 VDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAG----IQKGSCFFNGWG 160
            .:..|..::.|..:......|::|||.....|..|. .|:.|:.|....    |...:||..|||
Mosquito   331 QERTVSRVLVHPNYYSGALFNDLALLFFSEPFNDTV-ANVEPVCLSSPSGTDYIPPDNCFVTGWG 394

  Fly   161 KV----YLNSTDYPTVLKTV-----QVDLLSMGMCSSR-KLPIQQICGKGLEGID-CSGDGGAPL 214
            ..    ...|....:.|:.|     :..|.|:....|: ||....:|. ..:|.| |.|.||:|.
Mosquito   395 GSPKGNRAQSIQQYSKLQLVERHRCETQLQSLPTLGSKFKLHQSFVCA-ATDGTDVCQGSGGSPY 458

  Fly   215 VCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            .|.   ...:|..||||:| .....:....|.|||..|..||
Mosquito   459 ACE---RDGRYYLVGIVSW-GVGCGDGIPAVLTNVTELREWI 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 70/237 (30%)
Tryp_SPc 39..256 CDD:214473 68/235 (29%)
AgaP_AGAP000290XP_310831.5 Tryp_SPc 265..499 CDD:238113 70/237 (30%)
Tryp_SPc 265..496 CDD:214473 68/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.