DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CLIPA3

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_024667072.1 Gene:CLIPA3 / 1268922 VectorBaseID:AGAP012591 Length:422 Species:Anopheles gambiae


Alignment Length:257 Identity:74/257 - (28%)
Similarity:110/257 - (42%) Gaps:29/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVNSQYFNYNQIRRETYGSNPRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTK 79
            :.||.....||   ..||.     :||.|.:|...|   .|:|.|:||:...||||||.::..|.
Mosquito   173 IANSPAVTANQ---AAYGE-----YPWQVVLLGPGD---VYVGSGALIDNLHVLTAAHKISDYTS 226

  Fly    80 --YDLVVRAGEWDTSTTADQQHV-DLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIP 141
              ..|.||.||||.::|.:...| :..|.....|..|...|..|::|:|.|.....:.....:..
Mosquito   227 GTRALKVRLGEWDAASTTEPLPVQEFTVARYFVHPSFTAANLRNDIAILRLSGTVALGTTPTIAT 291

  Fly   142 LYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPIQQ----------- 195
            ..|.........|:.:||||....|..:.::.|.|.|.:::...|.:.....:.           
Mosquito   292 ACLPVTSFVGSRCWVSGWGKNDFVSGAFQSIPKEVDVPIVNSANCQTALRTTRLGGNFVLDTTSF 356

  Fly   196 ICGKGLEGID-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            :|..|..|.| |:||||:||||.:..   ::..||:|.|...........|:.|||..:.||
Mosquito   357 LCAGGELGKDACTGDGGSPLVCALNN---RWYVVGLVAWGIGCGANGIPGVYVNVASYITWI 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 68/233 (29%)
Tryp_SPc 39..256 CDD:214473 66/231 (29%)
CLIPA3XP_024667072.1 Tryp_SPc 182..418 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.