DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Ctrl

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:263 Identity:74/263 - (28%)
Similarity:121/263 - (46%) Gaps:26/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TLIISLVNSQY----------FNYNQIRRETYGSNP-RATFPWVVSVLDQRDWLFRYIGVGSLIN 63
            ||.:.|:.|.:          .:|||  |...|.|. ..::||.||:.|...  |.:.| ||||.
  Rat     7 TLSLVLLGSSWGCGVPAITPALSYNQ--RIVNGENAVPGSWPWQVSLQDNTG--FHFCG-GSLIA 66

  Fly    64 PNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILV 128
            ||.|:||||......::.:::  ||:|.|:.|:...| |.:...::|..:|.....|::.||.|.
  Rat    67 PNWVVTAAHCKVTPGRHFVIL--GEYDRSSNAEPIQV-LSISKAITHPSWNPNTMNNDLTLLKLA 128

  Fly   129 SAFEMTANINLIPLYLQEAGIQKG-SCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCS---SR 189
            |....||.::.:.|......:..| :|...|||::.......|..|:.|.:.|:::..|.   ..
  Rat   129 SPARYTAQVSPVCLASSNEALPAGLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGS 193

  Fly   190 KLPIQQICGKGLEGIDCSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLP 254
            ::....||..|.....|.||.|.||||:   ....:..:|||:|.::........::|.|:....
  Rat   194 RITDSMICAGGAGASSCQGDSGGPLVCQ---KGNTWVLIGIVSWGTENCNVQAPAMYTRVSKFNT 255

  Fly   255 WID 257
            ||:
  Rat   256 WIN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/223 (29%)
Tryp_SPc 39..256 CDD:214473 62/220 (28%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 65/232 (28%)
Tryp_SPc 34..260 CDD:238113 66/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.