DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Prss29

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:261 Identity:67/261 - (25%)
Similarity:109/261 - (41%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SNPRATFPWVVSVLDQRDWLFRYIGV-------GSLINPNVVLTAAHILNGTTKYDLVVRAGEWD 90
            |.|:..:||.||:.     ::||...       ||:|:|..||||||.:.            |.|
Mouse    36 SAPQGKWPWQVSLR-----IYRYYWAFWVHNCGGSIIHPQWVLTAAHCIR------------ERD 83

  Fly    91 TSTTADQQHVD----------LEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQ 145
            ...:..:..|.          |.|..::.|..|......:::|||.|..:.:...|:..:.|..:
Mouse    84 ADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSE 148

  Fly   146 EAGI-QKGSCFFNGWGKVYLN-STDYPTVLKTVQVDLLSMGMCS------------SRKLPIQQI 196
            ...: :|..|:..|||.|..: |...|..|:.|||.::...:|.            .:||.::.:
Mouse   149 SLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDM 213

  Fly   197 CGKGLEGID-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHL 260
            ...|.:|.| |.||.|.||||.:..   .:..||:|:|.....:.:...|:..|...||||...:
Mouse   214 LCAGNQGQDSCYGDSGGPLVCNVTG---SWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQM 275

  Fly   261 R 261
            :
Mouse   276 Q 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 65/251 (26%)
Tryp_SPc 39..256 CDD:214473 63/248 (25%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 67/257 (26%)
Tryp_SPc 31..271 CDD:214473 65/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.