DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Prss28

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:289 Identity:71/289 - (24%)
Similarity:119/289 - (41%) Gaps:53/289 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTTLIISLVNSQYF--NYNQIRRETYG-----SNPRATFPWVVSV----LDQRDWLFRYIGVGSL 61
            |..|.:|.:.|..|  :.:..|.:..|     ..|...:||.||:    .:...|:  :|..||:
Mouse     4 LLLLALSCLESTVFMASVSISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWV--HICGGSI 66

  Fly    62 INPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLI 126
            |:|..:|||||.:........|.|....:.....:|:.  |.:..|:.|..:|..:...::||:.
Mouse    67 IHPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQEL--LNISRIIIHPDYNDVSKRFDLALMQ 129

  Fly   127 LVSAFEMTANINLIPLYLQEAGIQK-GSCFFNGWG----KVYLNSTDYPTVLKTVQVDLLSMGMC 186
            |.:....:.|::.:.|....:.... ..|:..|||    :|.|..   |..|..|::.:.....|
Mouse   130 LTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQP---PYQLHEVKIPIQDNKSC 191

  Fly   187 --SSRKLPIQQ----------IC----GKGLEGIDCSGDGGAPLVCRILTYPYKYAQVGIVNWLS 235
              :.||....:          :|    |:|    .|.||.|.||||   ....|:.|||:|:   
Mouse   192 KRAYRKKSSDEHKAVAIFDDMLCAGTSGRG----PCFGDSGGPLVC---WKSNKWIQVGVVS--- 246

  Fly   236 QKPVE---NTFIVFTNVAGLLPWIDYHLR 261
             |.::   |...:|:.|...|.||..|::
Mouse   247 -KGIDCSNNLPSIFSRVQSSLAWIHQHIQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 62/247 (25%)
Tryp_SPc 39..256 CDD:214473 60/244 (25%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 63/258 (24%)
Tryp_SPc 31..269 CDD:214473 61/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.