DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and AgaP_AGAP012946

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_003436544.1 Gene:AgaP_AGAP012946 / 11175517 VectorBaseID:AGAP012946 Length:318 Species:Anopheles gambiae


Alignment Length:225 Identity:62/225 - (27%)
Similarity:103/225 - (45%) Gaps:23/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKY--DLVVRAGEWDTSTTADQQHVDLEVLNIVS 109
            :|.|:.|| .| |:||:...:|||||..    .|  .::||.||:||....|.:: |.::.:|..
Mosquito    94 NQWDYDFR-CG-GTLISDQHILTAAHCF----AYGDPVIVRVGEYDTELETDDEY-DSDIASIRR 151

  Fly   110 HEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFF-NGWGKVYLNSTDYPTVL 173
            |..::...:.:::||:.|.....::.:|.  |..|.|...:..:.:. .|:|......|...||:
Mosquito   152 HPNYSNLRSYDDIALVKLKHPIVLSKHIR--PACLWETEERNSTRYIATGFGYNETYGTTLSTVM 214

  Fly   174 KTVQVDLLSMGMCSSR-------KLPIQ--QIC-GKGLEGID-CSGDGGAPLVCRILTYPYKYAQ 227
            ..|.:|...:..|...       |..::  |:| |..:||.| |.||.|.||.....|....|..
Mosquito   215 MKVNLDEFPVSDCERNFKGDRRFKQGVRDGQLCVGSIVEGRDTCQGDSGGPLQVVTNTKSCSYGV 279

  Fly   228 VGIVNWLSQKPVENTFIVFTNVAGLLPWID 257
            |||.:......:.|...::|.|:..:.||:
Mosquito   280 VGITSVGGVCGIGNAKAIYTKVSHYIDWIE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 62/225 (28%)
Tryp_SPc 39..256 CDD:214473 60/222 (27%)
AgaP_AGAP012946XP_003436544.1 Tryp_SPc 69..311 CDD:238113 62/225 (28%)
Tryp_SPc 69..308 CDD:214473 60/222 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.