DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and F11

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_082342.1 Gene:F11 / 109821 MGIID:99481 Length:624 Species:Mus musculus


Alignment Length:251 Identity:72/251 - (28%)
Similarity:106/251 - (42%) Gaps:48/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NPRAT---------FPWVVSV-LDQRDWLFRYIGVGSLINPNVVLTAAHILNG--TTK----YDL 82
            |||..         :||.|:: :.|     .::..||:|....:|||||..:|  |.|    |..
Mouse   387 NPRVVGGAASVHGEWPWQVTLHISQ-----GHLCGGSIIGNQWILTAAHCFSGIETPKKLRVYGG 446

  Fly    83 VVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEA 147
            :|...|.:..|..      ..|..::.|:|:....:..::|||.|.||...|....  |:.|...
Mouse   447 IVNQSEINEGTAF------FRVQEMIIHDQYTTAESGYDIALLKLESAMNYTDFQR--PICLPSK 503

  Fly   148 GIQKG---SCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSR----KLPIQQICGKGLEG-- 203
            |.:..   .|:..|||...|.. :..:.|:..:|.|:|...|.:|    |:..:.||....||  
Mouse   504 GDRNAVHTECWVTGWGYTALRG-EVQSTLQKAKVPLVSNEECQTRYRRHKITNKMICAGYKEGGK 567

  Fly   204 IDCSGDGGAPLVCRILTYPYKYAQVGIVNW---LSQKPVENTFIVFTNVAGLLPWI 256
            ..|.||.|.||.|:   |...:..|||.:|   ..||....   |:||||..:.||
Mouse   568 DTCKGDSGGPLSCK---YNGVWHLVGITSWGEGCGQKERPG---VYTNVAKYVDWI 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 69/237 (29%)
Tryp_SPc 39..256 CDD:214473 67/235 (29%)
F11NP_082342.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..376 CDD:128519
Tryp_SPc 389..617 CDD:214473 68/247 (28%)
Tryp_SPc 390..617 CDD:238113 67/246 (27%)
Heparin-binding. /evidence=ECO:0000250 547..550 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.