Sequence 1: | NP_001259904.1 | Gene: | CG4259 / 33385 | FlyBaseID: | FBgn0031389 | Length: | 270 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017952796.2 | Gene: | LOC108648818 / 108648818 | -ID: | - | Length: | 928 | Species: | Xenopus tropicalis |
Alignment Length: | 234 | Identity: | 62/234 - (26%) |
---|---|---|---|
Similarity: | 102/234 - (43%) | Gaps: | 50/234 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 TFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAH--ILNGTTKYDLVVRAGEWDTSTTADQQHV 100
Fly 101 DLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGI---QKGSCFFNGWGKV 162
Fly 163 -YLNSTDYPTVLKTVQVDLLSMGMCSS-----RKLPIQQICGKGLEG-ID-CSGDGGAPLVCR-- 217
Fly 218 ---------ILTY---------PYKYAQVGIV-NWLSQK 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4259 | NP_001259904.1 | Tryp_SPc | 39..259 | CDD:238113 | 62/233 (27%) |
Tryp_SPc | 39..256 | CDD:214473 | 62/233 (27%) | ||
LOC108648818 | XP_017952796.2 | Tryp_SPc | 698..925 | CDD:238113 | 61/232 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |