DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:247 Identity:71/247 - (28%)
Similarity:105/247 - (42%) Gaps:38/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GSNPRAT-FPWVVSVLDQRDWLFRYIGV---GSLINPNVVLTAAHILNGTTK-YDLVVRAGEWDT 91
            |.|..|. :||..|       |:.|.|.   |||||...||:|||..||... :.|.|..|. .|
Zfish   311 GQNSSAVHWPWQAS-------LYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFYLTVILGP-KT 367

  Fly    92 STTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCF- 155
            ....|...:...|..::.|..:|....:|::||:.|  :|.:|...::.|:.|    ..:||.| 
Zfish   368 QNKYDPSRISRSVKAVIKHPYYNPNTNDNDIALVRL--SFPITFTDSIRPVCL----AAEGSVFN 426

  Fly   156 --FNGWGKVYLNSTD-----YPTVLKTVQVDLLSMGMCSS----RKLPIQQICGKGL--EGID-C 206
              ...|...:.|.:|     .|.:.:.|:|.::....|:.    ..:....||. ||  ||.| |
Zfish   427 SDTESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMICA-GLLKEGKDLC 490

  Fly   207 SGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDY 258
            .||.|.|:|....:.   :.|.|||::.|.........|:|.|:....||.|
Zfish   491 QGDSGGPMVSNQSSV---WVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWITY 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 68/239 (28%)
Tryp_SPc 39..256 CDD:214473 65/235 (28%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 68/243 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.