DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and ovch2

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_031756362.1 Gene:ovch2 / 100496902 XenbaseID:XB-GENE-955935 Length:1023 Species:Xenopus tropicalis


Alignment Length:272 Identity:69/272 - (25%)
Similarity:116/272 - (42%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NQIRRETYG-SNPRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAH-ILNGTTKYDLVVRA 86
            |.:.|...| .:.:...||.||:  :|:.  ::...|.|::...||||:| :|:...|..:.|..
 Frog    59 NYLSRIVGGRESKKGQHPWTVSL--KRNG--KHFCGGILVSRRHVLTASHCLLDRNVKSYIRVFF 119

  Fly    87 GEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAEN-NMALLILVSAFEMTANINLIPLYLQEAGIQ 150
            ||:|.:...|.:.. .:|:.|..|..||.....| ::|:|:|..|.....||....:...:...:
 Frog   120 GEYDQTIKEDTEQT-FKVIEIFKHPDFNYTQPMNYDVAVLVLDGAVTFDDNIQPACMPNPDDVFE 183

  Fly   151 KGS-CFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMC-----------SSRKLPIQQICGKGLEG 203
            .|. |...|||.:..|.. .|.||:.|.:.|:::.:|           .|.|:    :|....||
 Frog   184 PGDLCVTLGWGHLTENGI-LPGVLQEVLLPLVNLSICLDVMATLKGAVVSSKI----VCAGFPEG 243

  Fly   204 --IDCSGDGGAPLVCR------ILTYPYKYAQVGIVNW---LSQKPVENTFI---------VFTN 248
              ..|.||.|.||:|:      :|.        |:.:|   ..:....|.|:         :||:
 Frog   244 GKDACQGDSGGPLLCQRRHGTWVLH--------GLTSWGMGCGRSWKNNMFLPANRKGSPGIFTD 300

  Fly   249 VAGLLPWIDYHL 260
            :..||.|:.:.|
 Frog   301 IQKLLGWVSFQL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 65/253 (26%)
Tryp_SPc 39..256 CDD:214473 64/250 (26%)
ovch2XP_031756362.1 Tryp_SPc 64..309 CDD:238113 66/262 (25%)
CUB 330..436 CDD:238001
CUB 447..558 CDD:238001
Tryp_SPc 606..832 CDD:238113
CUB 888..1000 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.