DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and LOC100495541

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_031749237.1 Gene:LOC100495541 / 100495541 -ID:- Length:659 Species:Xenopus tropicalis


Alignment Length:239 Identity:68/239 - (28%)
Similarity:102/239 - (42%) Gaps:33/239 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGV----GSLINPNVVLTAAH-ILNGTTKYDLVVRAGEWDTSTTADQQ 98
            :||.||:        ||.|:    ||:|..:.:||||| .|...:..|..||.|.:..|.|:..:
 Frog    55 WPWQVSL--------RYKGIHICGGSVIGTHWILTAAHCFLISQSPSDFEVRLGAYQLSLTSPNE 111

  Fly    99 HVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKG-SCFFNGWG-K 161
             :..:|..|:.:.||:..:...::||:...|....|..|..:.|........:| .|:..||| .
 Frog   112 -ITYKVDRIIVNSQFDSSSHYGDIALIRPTSPITYTPYILPVCLPSTSNSFPEGMECWVTGWGTT 175

  Fly   162 VYLNSTDYPTVLKTVQVDLLSMGMC------------SSRKLPIQQICGKGLEG--IDCSGDGGA 212
            .:..:..||..|:.|...|:|...|            |:..:|..|||.....|  ..|.||.|.
 Frog   176 AFQVNLPYPQTLQQVMTPLISRTSCDQMYHIGTNVPSSTAIIPSDQICAGYAAGQKDSCQGDSGG 240

  Fly   213 PLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            ||||::....|   |:|.|.|.....:.|...|:|.|.....|:
 Frog   241 PLVCKLQGIWY---QIGFVTWGDGCAIANRPGVYTLVPAYQSWL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 68/239 (28%)
Tryp_SPc 39..256 CDD:214473 67/237 (28%)
LOC100495541XP_031749237.1 Tryp_SPc 44..283 CDD:238113 68/239 (28%)
Tryp_SPc 362..595 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.