DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and LOC100490440

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002939183.3 Gene:LOC100490440 / 100490440 -ID:- Length:565 Species:Xenopus tropicalis


Alignment Length:190 Identity:46/190 - (24%)
Similarity:71/190 - (37%) Gaps:59/190 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PWVVSVLDQRDWLFRYIGV-GSLINPNVVLTAAHILNGTTKYDLVVRA--GEWDTSTTADQ--QH 99
            |::..:||....:...:|| ||  |.:.:|   |.|:......|:|:|  |..:.....||  ::
 Frog   249 PYLSILLDIPPPVPAIVGVAGS--NKDTIL---HGLSDPPMSGLLVKALPGPGNPPLPVDQYLEN 308

  Fly   100 VDLE---VLNIVSHEQFNRFNAENNMALLILVSAFEMTA-NINLIPLYLQEAGIQK--GSCFFNG 158
            :.||   |..||.....|.|.|       .||.|..... :..||....:::|.:|  |   .:|
 Frog   309 LQLESCDVYLIVESGLNNSFRA-------TLVEALVAAGKHCMLIAGEGRQSGEEKEPG---HDG 363

  Fly   159 WGK-VYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPIQQICGKGLEGIDCSGDGGAPLVCR 217
            .|| .||.:||                                |.|:..:.:.|||.:.|
 Frog   364 EGKRAYLGATD--------------------------------LRGLKVALEKGAPQLVR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 46/190 (24%)
Tryp_SPc 39..256 CDD:214473 46/190 (24%)
LOC100490440XP_002939183.3 P-loop_NTPase 32..218 CDD:422963
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.