DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and tmprss15

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_001919639.2 Gene:tmprss15 / 100148042 ZFINID:ZDB-GENE-091204-83 Length:990 Species:Danio rerio


Alignment Length:262 Identity:67/262 - (25%)
Similarity:106/262 - (40%) Gaps:65/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NQIRRETYGSN----------PRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTT 78
            ::|..||.|..          .|..:||:||:    .||..:....:||:...::||||.:.|..
Zfish   734 SKIIEETDGKKEGRVVGGQDAQRGAWPWMVSL----QWLGGHACGATLIDREWLITAAHCVYGRN 794

  Fly    79 KYDLVVRAGEWDTSTTADQQHVDLEVLN----------IVSHEQFNRFNAENNMALLILVSAFEM 133
                 |:...|   ......|...|.:|          ::.|:.:|:...|::.||:.|.:....
Zfish   795 -----VQLSNW---AAVLGLHAQFETINPNKQVFSVDQVIMHKHYNKRTKESDFALMHLKTPVSY 851

  Fly   134 TANINLIPLYLQEAG--IQKG-SCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLP--- 192
            |..:.  |:.|.:.|  .::| .||..||| :...|.....||:...|.|||...| ...||   
Zfish   852 TDYVQ--PICLPDPGAHFEEGRKCFIAGWG-LLSESGLKADVLQQAVVPLLSNTQC-QEWLPEYN 912

  Fly   193 --IQQIC-GKGLEGID-CSGDGGAPLVCR-----ILT-------------YPYKYAQVG-IVNWL 234
              .:.:| |....|:| |.||.|.||:|.     :|.             .|..||:|. .|:|:
Zfish   913 FTERMMCAGYAEGGVDTCQGDSGGPLMCEEEGHWVLVGATSFGIGCGRPQRPGAYARVSQFVDWV 977

  Fly   235 SQ 236
            ::
Zfish   978 AE 979

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 62/237 (26%)
Tryp_SPc 39..256 CDD:214473 62/237 (26%)
tmprss15XP_001919639.2 SEA 19..>89 CDD:279699
LDLa 142..175 CDD:238060
CUB 183..288 CDD:238001
MAM 302..457 CDD:279023
MAM 302..457 CDD:99706
CUB 477..586 CDD:238001
LDLa 596..630 CDD:238060
SRCR_2 653..728 CDD:295335
Tryp_SPc 747..977 CDD:214473 62/245 (25%)
Tryp_SPc 748..980 CDD:238113 63/248 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.