DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and gzma

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:171 Identity:44/171 - (25%)
Similarity:73/171 - (42%) Gaps:19/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GSLINPNVVLTAAH-ILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNM 122
            |:||..|.|||||| ::|.:.    |:.......|...:||.  ..|...:.|..|......:::
 Frog    61 GTLIKQNWVLTAAHCVVNNSE----VILGAHKVKSRENEQQR--FSVARAIPHPCFEWKKKIHDI 119

  Fly   123 ALLILVSAFEMTANINLIPLYLQEAGIQKG-SCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMC 186
            .||.:..|.::...::::.|...:..::.| ||...|||....|......||:.|.|.::..|.|
 Frog   120 QLLQIKGAAKLNKFVSVLKLPTTDMDVKPGSSCSTAGWGVTKPNGKTPSDVLREVNVTVVDRGTC 184

  Fly   187 S------SRKLPIQQICGKGLEGID-----CSGDGGAPLVC 216
            :      ..::....:|....:..|     |.||.|.||:|
 Frog   185 NKIYKKFKTEISTNMLCAGAPKKSDKKYDACQGDSGGPLIC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 44/171 (26%)
Tryp_SPc 39..256 CDD:214473 44/171 (26%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 44/171 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.