DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and zgc:165423

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:280 Identity:69/280 - (24%)
Similarity:106/280 - (37%) Gaps:67/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GSNPRA-TFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHIL-NGTTKYDLVVRAGEWDTSTT 94
            |:|..| ::||..|:.:...   .:.| ||||:...:|:|||.. :.....|..|..|. .:...
Zfish    41 GTNASAGSWPWQASLHESGS---HFCG-GSLISDQWILSAAHCFPSNPNPSDYTVYLGR-QSQDL 100

  Fly    95 ADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFN-- 157
            .:...|...|..::.|..:.....:|:||||.|.|....:..|..:.|      ...||.|:|  
Zfish   101 PNPNEVSKSVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNYIQPVCL------AADGSTFYNDT 159

  Fly   158 ----GWGKVYLN-STDYPTVLKTVQVDLLSMGMCS-----SRKLPIQQICGKGLEG--IDCSGDG 210
                |||.:... |...|.:|:.|.|.::...:|:     ...:....:|...::|  ..|.||.
Zfish   160 MWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLYGGGSSITNNMMCAGLMQGGKDSCQGDS 224

  Fly   211 GAPLV------------------CRILTYPYKYAQVG-IVNWLSQKPVENTFI-VFTNV------ 249
            |.|:|                  |....||..||:|. ..||:||. |..:|| |..|.      
Zfish   225 GGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQY-VRASFIPVDVNAPIQDDS 288

  Fly   250 -------------AGLLPWI 256
                         |.:.||:
Zfish   289 ETCPTKPTLCGGSASVYPWM 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 66/272 (24%)
Tryp_SPc 39..256 CDD:214473 65/270 (24%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 58/236 (25%)
Tryp_SPc 38..269 CDD:238113 59/238 (25%)
Tryp_SPc 299..473 CDD:304450 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.