DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Gm2663

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:229 Identity:65/229 - (28%)
Similarity:101/229 - (44%) Gaps:26/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTST-TADQQ 98
            |:.:.|:.||:   .|.:....| |||||...||:|||..    |..|.||.||.:... ...:|
Mouse    31 PKHSVPYQVSL---NDGISHQCG-GSLINDQWVLSAAHCY----KRRLQVRLGEHNIDVLEGGEQ 87

  Fly    99 HVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVY 163
            .:|.|  .|:.|..:|:...:|::.|:.|.|...:.:.::.:.| .:........|..:|||...
Mouse    88 FIDAE--KIIRHPDYNKDTVDNDIMLIKLKSPAILNSQVSTVSL-PRSCASTNAQCLVSGWGNTV 149

  Fly   164 LNSTDYPTVLKTVQVDLLSMGMCSSR---KLPIQQICGKGLEG--IDCSGDGGAPLVCRILTYPY 223
            .....||.:|:.::..:||...|...   ::.....|...|||  ..|.||.|.|:||.      
Mouse   150 SIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCN------ 208

  Fly   224 KYAQV-GIVNWLSQKPVENTFIVFTNVAGLLPWI 256
              .:: |||:|.|...:.....|:|.|...|.||
Mouse   209 --GEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/225 (28%)
Tryp_SPc 39..256 CDD:214473 62/223 (28%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 63/227 (28%)
Tryp_SPc 24..243 CDD:238113 65/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.