DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and LOC100004427

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:285 Identity:67/285 - (23%)
Similarity:106/285 - (37%) Gaps:88/285 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTTLIISLVNSQYFNYNQIRRETYGSNPRATFPWVVSVLDQRDWLFRYIG----VGSLINPNVVL 68
            |.|.|:..:|:           |.||     :||..|:      .|:..|    .||||:...||
Zfish    32 LNTKIVGGLNA-----------TEGS-----WPWQASI------NFKSTGQFFCSGSLISERWVL 74

  Fly    69 TAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEM 133
            |||.........|:|:..|.. |:..::...:...|:.:         :...::||:.|.|:...
Zfish    75 TAASCFQRINVSDVVIYLGRL-TTNGSNPYEIPRTVIQV---------SVTEDIALVQLSSSVTF 129

  Fly   134 TANINLIPLYLQEAG---IQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPIQQ 195
            |..|.  |:.|..||   :.....:..|||.....:.....:||.|:..:::...||:    |..
Zfish   130 TDYIR--PVCLAAAGSVFVDGTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIECSN----ING 188

  Fly   196 ICGKGLEGIDCSG------------DGGAPLVCR-----------ILT------YPYKYAQVG-- 229
            |  ..|:.:.|:|            |.|:|||.|           :.|      :|..||:|.  
Zfish   189 I--TNLDNVICAGFVNETGKAPCWEDFGSPLVTRQGSQWIQSGVVVFTFCGQNGFPTLYARVSEY 251

  Fly   230 ---IVNWLSQK-------PVENTFI 244
               |.|:.|..       ||..||:
Zfish   252 EEWIRNYTSSSLPGFLSYPVIYTFM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 60/254 (24%)
Tryp_SPc 39..256 CDD:214473 60/254 (24%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 58/259 (22%)
Tryp_SPc 36..257 CDD:238113 59/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.