Sequence 1: | NP_001259904.1 | Gene: | CG4259 / 33385 | FlyBaseID: | FBgn0031389 | Length: | 270 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005163955.1 | Gene: | LOC100004427 / 100004427 | -ID: | - | Length: | 302 | Species: | Danio rerio |
Alignment Length: | 285 | Identity: | 67/285 - (23%) |
---|---|---|---|
Similarity: | 106/285 - (37%) | Gaps: | 88/285 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 LTTLIISLVNSQYFNYNQIRRETYGSNPRATFPWVVSVLDQRDWLFRYIG----VGSLINPNVVL 68
Fly 69 TAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEM 133
Fly 134 TANINLIPLYLQEAG---IQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPIQQ 195
Fly 196 ICGKGLEGIDCSG------------DGGAPLVCR-----------ILT------YPYKYAQVG-- 229
Fly 230 ---IVNWLSQK-------PVENTFI 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4259 | NP_001259904.1 | Tryp_SPc | 39..259 | CDD:238113 | 60/254 (24%) |
Tryp_SPc | 39..256 | CDD:214473 | 60/254 (24%) | ||
LOC100004427 | XP_005163955.1 | Tryp_SPc | 35..255 | CDD:214473 | 58/259 (22%) |
Tryp_SPc | 36..257 | CDD:238113 | 59/260 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170587429 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |