DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:234 Identity:55/234 - (23%)
Similarity:86/234 - (36%) Gaps:66/234 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAA------------------HILNGTTKYDLVV 84
            ::||.|.:....:   .::..||:|..|.||:||                  |:|||..:::.| 
Zfish    42 SWPWQVDIQMGSN---GHVCGGSIIAKNWVLSAAHCFPNPSEVSAYTLYMGRHLLNGYNQFEKV- 102

  Fly    85 RAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGI 149
                             ..|..:|..|.:.......::||:.|.:....|..|.  |:.|..|..
Zfish   103 -----------------SYVQRVVIPEGYTDPQGGRDVALVQLRAPVSWTDRIQ--PVCLPFADF 148

  Fly   150 QKGS---CFFNGWGK----VYLNSTDYPTVLKTVQVDLLSMGMC-----------SSRKLPIQQI 196
            |..|   |:..|||.    |.|...   ..|:.|:|.::....|           |:..:....|
Zfish   149 QFNSGTLCYVTGWGHKQEGVSLTGA---AALREVEVPIIDQSSCQFMYQILSSDSSTVDILSDMI 210

  Fly   197 CGKGLEG--IDCSGDGGAPLVCRILTYPYKYAQVGIVNW 233
            |....||  ..|.||.|.||||.:..  ..:.|.|:|::
Zfish   211 CAGYKEGGKDSCQGDSGGPLVCPVGN--GTWIQAGVVSF 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 55/233 (24%)
Tryp_SPc 39..256 CDD:214473 55/233 (24%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 55/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.