DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or94a

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:417 Identity:80/417 - (19%)
Similarity:146/417 - (35%) Gaps:95/417 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IVGLWPQRIRGGGGRPW--------------HAHLLFVF-------AFAMVVVGAVGEVSYGCVH 66
            :.||||..::  ....|              |..:.|.|       ||....:...|:|.|..:.
  Fly    20 LFGLWPWSLK--SEEEWTFTGFVKRNYRFLLHLPITFTFIGLMWLEAFISSNLEQAGQVLYMSIT 82

  Fly    67 LDNLVVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQRLRAILWESRRQE-------AQRMLV 124
            ...|||.             :|.:|.:  ....|..:.:...|..::...||       .||...
  Fly    83 EMALVVK-------------ILSIWHY--RTEAWRLMYELQHAPDYQLHNQEEVDFWRREQRFFK 132

  Fly   125 GLATTANRLSLLLLSSGTATNAAFTLQPLIMGLYRWIVQLPGQTELPFNIILPS---------FA 180
            ........:||.::.|| .|...|               |.|. ||||...:|.         ||
  Fly   133 WFFYIYILISLGVVYSG-CTGVLF---------------LEGY-ELPFAYYVPFEWQNERRYWFA 180

  Fly   181 VQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSCLYICGAFRLVQQDIRRIFADLHGDSVDVFT 245
            ..   :.:..:.||.....|:........|.| |.||.....||      |...::..|:  :|.
  Fly   181 YG---YDMAGMTLTCISNITLDTLGCYFLFHI-SLLYRLLGLRL------RETKNMKNDT--IFG 233

  Fly   246 EEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCST---ILDIMLNTSSLS 307
            :::.|        :...|..|........|..:..:|...:.:|.::|.:   :..:.:..:...
  Fly   234 QQLRA--------IFIMHQRIRSLTLTCQRIVSPYILSQIILSALIICFSGYRLQHVGIRDNPGQ 290

  Fly   308 GLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTI 372
            .::.:.::...:.|::|.|:.||.::..:..:.:.:|...|.:|....||::...:...::..||
  Fly   291 FISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKPVTI 355

  Fly   373 -AVPFFTPSLPALRSILSTAGSYITLL 398
             |..||...||.....::.|.|::.||
  Fly   356 RAGNFFAVGLPIFVKTINNAYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 63/342 (18%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 66/358 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.