DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or85d

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:328 Identity:63/328 - (19%)
Similarity:134/328 - (40%) Gaps:39/328 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KLWVFFRSNRRWAELVQRLRAILWESRRQEAQRMLVGLATTANRLSLLLLSSGTATNAAFTLQPL 153
            |:|...|..:|..::|.||..:..:...|:....:....:..:|.|...          |.:..:
  Fly   104 KIWNISRQRKRLTQVVSRLEELHPQGLAQQEPYNIGHHLSGYSRYSKFY----------FGMHMV 158

  Fly   154 IMGLYR------------WIVQLPGQTELPFNIILPSFAVQPGVFPLTYVLLTASG-ACTVFAFS 205
            ::..|.            |:.....:..||:...:|........:...|:.....| ||      
  Fly   159 LIWTYNLYWAVYYLVCDFWLGMRQFERMLPYYCWVPWDWSTGYSYYFMYISQNIGGQAC------ 217

  Fly   206 FVDGFFICSCLYICGAFRLVQQDIRRIFADL--HGDSVDVFTEEMNAEVRHRLAQVVERHNAIID 268
             :.|......| :|....||.....|:.|.:  |...:..|..::..     |...|..|.::|.
  Fly   218 -LSGQLAADML-MCALVTLVVMHFIRLSAHIESHVAGIGSFQHDLEF-----LQATVAYHQSLIH 275

  Fly   269 FCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVS 333
            .|.|:...|.|.:|.:|:|::|::|.....:.:.:...:.:..:.::..|:.|:|:.......:.
  Fly   276 LCQDINEIFGVSLLSNFVSSSFIICFVGFQMTIGSKIDNLVMLVLFLFCAMVQVFMIATHAQRLV 340

  Fly   334 ESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTI-AVPFFTPSLPALRSILSTAGSYITL 397
            ::|..:...:|:.:|::.|.|.||::::|::|:|:...: |..|...||..:..:|..:..:..|
  Fly   341 DASEQIGQAVYNHDWFRADLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFAL 405

  Fly   398 LKT 400
            |:|
  Fly   406 LRT 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 60/318 (19%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 60/318 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.