DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or85a

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:367 Identity:65/367 - (17%)
Similarity:129/367 - (35%) Gaps:78/367 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LLFVF-AFAMVVVGAVGEVSYGCVHLDNLVVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQR 106
            |:|:| .:.:::.|.....::....|...|..     |..|.|..:..:.|.| ..||::...:.
  Fly    56 LVFIFIPYGLIMTGIKEFKNFTTTDLFTYVQV-----PVNTNASIMKGIIVLF-MRRRFSRAQKM 114

  Fly   107 LRAILWESRRQEAQRMLVGLATTANR------------LSLLLLSSGTATNAAFTL-QPLIMGLY 158
            :.|:.....:.|.:..:...|...||            ||:.|..:.......|.| .||:....
  Fly   115 MDAMDIRCTKMEEKVQVHRAAALCNRVVVIYHCIYFGYLSMALTGALVIGKTPFCLYNPLVNPDD 179

  Fly   159 RWIVQLPGQTELPFNIILPSFAVQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSCLYICGAFR 223
            .:.:....::.....|||.:..:.  |:|:.||:                               
  Fly   180 HFYLATAIESVTMAGIILANLILD--VYPIIYVV------------------------------- 211

  Fly   224 LVQQDIRRIFADLHGDSVDVF-TEEMNAEVRH--RLAQVVERHNAIIDFCTDLTRQFTVIVLMHF 285
                 :.||..:|..:.:... |:....:.:|  .|.:.|:.|..|:::...|....:..:.:..
  Fly   212 -----VLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDHKLIVEYGNTLRPMISATMFIQL 271

  Fly   286 LSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWYK 350
            ||...:|....:.:....:.:..:....|.||.|:|.|.:|:....:|....::.:.|:..:|..
  Fly   272 LSVGLLLGLAAVSMQFYNTVMERVVSGVYTIAILSQTFPFCYVCEQLSSDCESLTNTLFHSKWIG 336

  Fly   351 CDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILSTAG 392
            .:.|.|..:|..:...|                 :|||.|||
  Fly   337 AERRYRTTMLYFIHNVQ-----------------QSILFTAG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 58/338 (17%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 61/346 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.