DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or83c

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:238 Identity:50/238 - (21%)
Similarity:93/238 - (39%) Gaps:29/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 LQPLIMGLYRWIVQLPGQTELPFNIILPSFAVQPG-VFPLTYVLLTASGACTVFAFSFVDGFFIC 213
            |.||.|.:|      .|........::|...::.. .:.:||::.|.:.......|...|.|...
  Fly   147 LLPLAMLMY------DGTRVTAMQYLIPGLPLENNYCYVVTYMIQTVTMLVQGVGFYSGDLFVFL 205

  Fly   214 SCLYICGAFRLVQQDIRRIFADLH-----------GDSVDVFTEEMNAEVRHR-LAQVVERHNAI 266
            ....|.....::|..::.:...|.           |.|:|      .||.|.| |..|:..|...
  Fly   206 GLTQILTFADMLQVKVKELNDALEQKAEYRALVRVGASID------GAENRQRLLLDVIRWHQLF 264

  Fly   267 IDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNH 331
            .|:|..:...:..::....||.|..:   :|...:|.||....:.|.::::|.: :.:||..|..
  Fly   265 TDYCRAINALYYELIATQVLSMALAM---MLSFCINLSSFHMPSAIFFVVSAYS-MSIYCILGTI 325

  Fly   332 VSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTIAV 374
            :..:...|.:.:.::.||:.....||:...:||.||....|.:
  Fly   326 LEFAYDQVYESICNVTWYELSGEQRKLFGFLLRESQYPHNIQI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 50/238 (21%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 50/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.