DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or83a

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:452 Identity:85/452 - (18%)
Similarity:156/452 - (34%) Gaps:119/452 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LFVFAFAMVVVGAVGEVSYGCVHLDNLVVALEAFCPGTTKA-------------VC--------- 86
            ||||....:.:.|:....| .|:...::..|..||..|.:.             :|         
  Fly    19 LFVFVRQTMCIAAMYPFGY-YVNGSGVLAVLVRFCDLTYELFNYFVSVHIAGLYICTIYINYGQG 82

  Fly    87 ------------VLKLW-----VFFRSNRRWAELVQRLRAILWESRRQEAQRMLVGLA--TTANR 132
                        ::.||     ::||..|...     |..||.....:...|..||.:  |.|..
  Fly    83 DLDFFVNCLIQTIIYLWTIAMKLYFRRFRPGL-----LNTILSNINDEYETRSAVGFSFVTMAGS 142

  Fly   133 LSLLLLSSGTATNAAFTLQPLIMGLYRWIVQLP---GQTELPFNIILPSFAVQPGVFPLTYVLLT 194
            ..:..|...|.....:      :|...|:. ||   ....||.....|....||||:.:.: ||.
  Fly   143 YRMSKLWIKTYVYCCY------IGTIFWLA-LPIAYRDRSLPLACWYPFDYTQPGVYEVVF-LLQ 199

  Fly   195 ASGACTVFA-FSFVDGFFICSCLYICGAFRLVQQDIRRIFADLH--------------------- 237
            |.|...|.| |:...|..:..|:.|.|.:.::...::.:.|..:                     
  Fly   200 AMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTELNQLQAEQSAAD 264

  Fly   238 ----------------------GDSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVI 280
                                  |.|:|     .::..|....:.::.|..|:.....:...::.|
  Fly   265 VEPGQYAYSVEEETPLQELLKVGSSMD-----FSSAFRLSFVRCIQHHRYIVAALKKIESFYSPI 324

  Fly   281 VLMHFLSAAFVLCSTILDIMLNTSSLSGLTYI------CYIIAALTQLFLYCFGGNHVSESSAAV 339
            ..:......|::|   |...::|.|.:..:::      .|::..|.:||:.|:..:.|.::|...
  Fly   325 WFVKIGEVTFLMC---LVAFVSTKSTAANSFMRMVSLGQYLLLVLYELFIICYFADIVFQNSQRC 386

  Fly   340 ADVLYDMEWYK--CDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILSTAGSYITLLK 399
            .:.|:...|.:  .|.|:..:..|:..|.|...| |......::...|..::||.|::|||:
  Fly   387 GEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLT-AGKISNLNVDRFRGTITTAFSFLTLLQ 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 73/418 (17%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 53/301 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.