DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or67d

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:255 Identity:53/255 - (20%)
Similarity:100/255 - (39%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 IILPSFAVQPGVFPLTYVLLTASGACTV-FAFSFVD-----GFFICSCLYIC----GAFRLVQQD 228
            |||....:   .||:.|:|:.......: |...|:|     |..|.:..::.    |.|.....|
  Fly   144 IILLGLVI---TFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYGGD 205

  Fly   229 IRRIFADLHGDSV-DVFTEEMN------------AEVRHRLAQVVERHNAIIDFCTDLTRQFTVI 280
            :.......|...: |:|..::.            .:||..|..::..|...........:.::::
  Fly   206 MYLFLFVTHVPLIKDIFCVKLTEFNELVMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTKKIYSIV 270

  Fly   281 VLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLY- 344
            :.:...:....|..||..|.:.....:.| |:.|  ||:| |:.:|..|..|..|:.....|:| 
  Fly   271 LFVQLSTTCVGLLCTISCIFMKAWPAAPL-YLLY--AAIT-LYTFCGLGTLVENSNEDFLSVIYT 331

  Fly   345 DMEWYKCDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILSTAG--SYITLLKTFL 402
            :..||:...:..|:|:|:|.::|....:......| |....::..|.|  |:..:|..:|
  Fly   332 NCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAP-LSMNTALQLTKGIYSFSMMLMNYL 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 49/241 (20%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 50/243 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465025
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.