DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or67c

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster


Alignment Length:403 Identity:78/403 - (19%)
Similarity:156/403 - (38%) Gaps:68/403 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GRPWHAH--------LLF---VFA----FAMVVVGAVGEVSYGCVHLDNLVVALEAFCPGTTKAV 85
            |...:||        |||   ::|    |.::|:|.:       |...|.:...|........|.
  Fly    27 GEDIYAHRSTNPLKSLLFKIYLYAGFINFNLLVIGEL-------VFFYNSIQDFETIRLAIAVAP 84

  Fly    86 CV-------LKLWVFFRSNRRWAELVQRLRAILWESRRQEAQRMLVGLATTANRLSLLLLSSGTA 143
            |:       .|.....|..:....|:..|..:..::..::.:..|.....|..|:..:......|
  Fly    85 CIGFSLVADFKQAAMIRGKKTLIMLLDDLENMHPKTLAKQMEYKLPDFEKTMKRVINIFTFLCLA 149

  Fly   144 TNAAFTLQPLIMGLYRWIVQLPGQTELPFNII-LPSFAVQPGV---FP-------LTYVLL---T 194
            ....|:..|.|            :..:.||.: ..:|....|.   ||       |.|.::   .
  Fly   150 YTTTFSFYPAI------------KASVKFNFLGYDTFDRNFGFLIWFPFDATRNNLIYWIMYWDI 202

  Fly   195 ASGACTVFAFSFVDGF-FICSCLYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQ 258
            |.||       ::.|. |:|:.|.:......:......|...|.....:...::.|.|.   |..
  Fly   203 AHGA-------YLAGIAFLCADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKENIEF---LIG 257

  Fly   259 VVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLF 323
            ::..|:..:..|..:...::..:|::||.|:..:|.....:..:|..:. :.|..:::.::.|:|
  Fly   258 IIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVI-IIYCIFLMTSMVQVF 321

  Fly   324 LYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTIAVPFFTP-SLPALRSI 387
            :.|:.|:.:..:|..|.|..|:.:|::|......::.:::.|||:..:|..|.|.| ||.....:
  Fly   322 MVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKV 386

  Fly   388 LSTAGSYITLLKT 400
            :|.:..:..||:|
  Fly   387 ISMSYQFFALLRT 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 64/345 (19%)
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 60/327 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.