DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or67a

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster


Alignment Length:280 Identity:62/280 - (22%)
Similarity:122/280 - (43%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 AFTLQPL-IMGLYRWIVQLPGQTELPFNIILPSFAVQP------GVFPLTYVLLTASGACTVFAF 204
            |..|.|| |..:.|.::..|...:     |:|.:.::|      .:|..:|...:::|       
  Fly   154 AHALIPLFIYFIQRVLLHYPDAKQ-----IMPFYQLEPWEFRDSWLFYPSYFHQSSAG------- 206

  Fly   205 SFVDGFFICSCLYICG---AFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRH----------RL 256
                  :..:|..|.|   .|.:|.|.|      :|.:.:.....|...:..:          :|
  Fly   207 ------YTATCGSIAGDLMIFAVVLQVI------MHYERLAKVLREFKIQAHNAPNGAKEDIRKL 259

  Fly   257 AQVVERHNAIIDFCTDLTRQ-FTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYIC----YII 316
            ..:|..|..|:.. |||..: |.:.:|::|:::|.::|  ::.:.| |.:||. .|.|    ::|
  Fly   260 QSLVANHIDILRL-TDLMNEVFGIPLLLNFIASALLVC--LVGVQL-TIALSP-EYFCKQMLFLI 319

  Fly   317 AALTQLFLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTI-AVPFFTPS 380
            :.|.:::|.|.....:.::|..|....|||:|...|.|.:|:::.|..|||:...: |......|
  Fly   320 SVLLEVYLLCSFSQRLIDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATVVLDLS 384

  Fly   381 LPALRSILSTAGSYITLLKT 400
            :|.:...|..:..:...::|
  Fly   385 MPTMSIFLGMSYKFFCAVRT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 61/270 (23%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 61/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.