DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or59c

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:440 Identity:89/440 - (20%)
Similarity:158/440 - (35%) Gaps:123/440 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ADHFYRIPRISG----------LIVGLWPQRIRGGG--GRPWHAHLLFVFAF-----------AM 51
            :|::|||....|          .|..||.......|  ..|....|.:|..|           ..
  Fly    24 SDYYYRIAFFLGWTPPKGALLRWIYSLWTLTTMWLGIVYLPLGLSLTYVKHFDRFTPTEFLTSLQ 88

  Fly    52 VVVGAVGEVSYGCV---------HLDNLVVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQRL 107
            |.:..:|.|...||         .::.|:.:|:..|..||:             .|.:.::|.|:
  Fly    89 VDINCIGNVIKSCVTYSQMWRFRRMNELISSLDKRCVTTTQ-------------RRIFHKMVARV 140

  Fly   108 RAILWESRRQEAQRMLVGLATTANRLSLLLLSSGTATNAAFTL-QPLI---MGLYR-WIVQLPGQ 167
            ..|           :::.|:|......|.|.:|..|..|.:.| .||:   .|.:: ||..:   
  Fly   141 NLI-----------VILFLSTYLGFCFLTLFTSVFAGKAPWQLYNPLVDWRKGHWQLWIASI--- 191

  Fly   168 TELPFNIILPSFAVQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSCLYICGAFRLVQQDIRRI 232
              |.:.::  |......:...||.::..|             .|.|....:......::||.:. 
  Fly   192 --LEYCVV--SIGTMQELMSDTYAIVFIS-------------LFRCHLAILRDRIANLRQDPKL- 238

  Fly   233 FADLHGDSVDVFTEEMNAEVRH--RLAQVVERHNAIIDFCTDLTR---------QFTVIVLMHFL 286
                             :|:.|  ::...::.|..||. |:.:.|         ||.::.:...|
  Fly   239 -----------------SEMEHYEQMVACIQDHRTIIQ-CSQIIRPILSITIFAQFMLVGIDLGL 285

  Fly   287 SAAFVLC--STILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWY 349
            :|..:|.  :||..||.|.|         :|:|..|:.|..|....|:.|.|..|::.|:...|.
  Fly   286 AAISILFFPNTIWTIMANVS---------FIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNWI 341

  Fly   350 KCDARTRKVILMILRRSQR-AKTIAVPFFTPSLPALRSILSTAGSYITLL 398
            ..|...:..:|..|.|:|: .:..|...|..|:.:..::...|.:.||::
  Fly   342 TADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 68/341 (20%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 73/377 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465107
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.