DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or56a

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:248 Identity:46/248 - (18%)
Similarity:87/248 - (35%) Gaps:39/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 PFNIILPSFAVQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSCLYICGAF-----RLVQQDIR 230
            ||..:..:|.|  |.....|.|     ...:.|......|..|...|:....     |:.:.||.
  Fly   189 PFGELCDNFVV--GYLGPWYAL-----GLGITAIPLWHTFITCLMKYVNLKLQILNKRVEEMDIT 246

  Fly   231 RI----------FADLHGDSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMHF 285
            |:          .::|....:.:|.|.:..::|.|            .|..:|.....|.|:..|
  Fly   247 RLNSKLVIGRLTASELTFWQMQLFKEFVKEQLRIR------------KFVQELQYLICVPVMADF 299

  Fly   286 LSAAFVLCSTILDIMLNTSSLSGLTY---ICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDME 347
            :..:.::|  .|...|.....|.:.|   ..|:......|::|.:....:.|....::...:...
  Fly   300 IIFSVLIC--FLFFALTVGVPSKMDYFFMFIYLFVMAGILWIYHWHATLIVECHDELSLAYFSCG 362

  Fly   348 WYKCDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILSTAGSYITLLKT 400
            ||..:...:|:::.::..:||...:.......:|.....|...|.||..||::
  Fly   363 WYNFEMPLQKMLVFMMMHAQRPMKMRALLVDLNLRTFIDIGRGAYSYFNLLRS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 41/238 (17%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 41/238 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.