DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or42b

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:386 Identity:81/386 - (20%)
Similarity:151/386 - (39%) Gaps:77/386 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LLFVFAFAMVVVGAVGEVSYGCVHLDNLVVALEAFCPG---TTKAVCV------LKLWVFFRSNR 98
            :.||:....:.:|.:|  ||        :..:::|.||   |:..||:      :|:.:.:    
  Fly    51 MTFVWCTTYLPLGFLG--SY--------MTQIKSFSPGEFLTSLQVCINAYGSSVKVAITY---- 101

  Fly    99 RWAELVQRLRAILWESRRQEAQRML--VGLATTA----NRLSLLLLSSGTATNAAFTLQPLIMGL 157
                      ::||  |..:|:.:|  :.|..||    .::.|::..|    |.||.:...:...
  Fly   102 ----------SMLW--RLIKAKNILDQLDLRCTAMEEREKIHLVVARS----NHAFLIFTFVYCG 150

  Fly   158 YRWIVQLPGQTEL--------PFNIILPSFAVQPGVFPL----TYVLLTASGACTVFAFSFVDGF 210
            |      .|.|.|        |:.:..|......|...|    |...:..|||  |......|.:
  Fly   151 Y------AGSTYLSSVLSGRPPWQLYNPFIDWHDGTLKLWVASTLEYMVMSGA--VLQDQLSDSY 207

  Fly   211 FICSCLYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMN-AEVRHRLAQVVERHNAIIDFCTDLT 274
            .:...|.:.....::::.|||:.:|          |.:: ||....|.:.|..|..|:.:|..:.
  Fly   208 PLIYTLILRAHLDMLRERIRRLRSD----------ENLSEAESYEELVKCVMDHKLILRYCAIIK 262

  Fly   275 RQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAV 339
            ......:...||....||..|::::...:...:|:....::|..|.|.|.:|:..|.:.|...::
  Fly   263 PVIQGTIFTQFLLIGLVLGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDCESL 327

  Fly   340 ADVLYDMEWYKCDARTRKVILMILRRSQRAKT-IAVPFFTPSLPALRSILSTAGSYITLLK 399
            ...::...|.....|.:..:|..|:..|:... ||...|..|:.:..|:...|.|.||:.|
  Fly   328 THAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 70/351 (20%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 69/342 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.