DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or22b

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:226 Identity:48/226 - (21%)
Similarity:96/226 - (42%) Gaps:37/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 FSFVD---GFFICS---------------CLYICGAFRLV---------QQDIRRIFADLHGDSV 241
            |.:||   .|:|.|               |..:|....:|         :|.:|.:.:: .|.:.
  Fly   174 FPYVDPEKQFYISSIAEVILRGWAVFMDLCTDVCPLISMVIARCHITLLKQRLRNLRSE-PGRTE 237

  Fly   242 DVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSL 306
            |.:.:|        ||..|..|..|:|:...|...|:..:.:.||....||..::::||..::..
  Fly   238 DEYLKE--------LADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLS 294

  Fly   307 SGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKT 371
            :|:..:.::.....|.|.:|:..|.:.:....:||.|:..:|...|.|.:..::..|...|:...
  Fly   295 TGVAVVLFMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPII 359

  Fly   372 I-AVPFFTPSLPALRSILSTAGSYITLLKTF 401
            : |...|..|:....:::..|.:.:|::|.|
  Fly   360 LTAGGVFPISMQTNLNMVKLAFTVVTIVKQF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 44/215 (20%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 44/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.