DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22c and Or2a

DIOPT Version :9

Sequence 1:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:208 Identity:54/208 - (25%)
Similarity:89/208 - (42%) Gaps:50/208 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 FICSCLYICGAFRLVQQDIRRIFADLH----GDSVDVFTEEMNAE----VR-----HRLAQVVER 262
            |:|   .:.|..|.::..:|||.....    |.:.:.:.||:..|    :|     |||.::::|
  Fly   205 FLC---LLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDLARVHRLREIIQR 266

  Fly   263 HNAI---IDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFL 324
            ..::   ..|......|.|  |.||||..|        |...:|:.:..   |.:..|...::|:
  Fly   267 VLSVPCMAQFVCSAAVQCT--VAMHFLYVA--------DDHDHTAMIIS---IVFFSAVTLEVFV 318

  Fly   325 YCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILS 389
            .|:.|:.:...|.|:.|..||..|.:...:.::.:|..|.|:||          ||       |.
  Fly   319 ICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQR----------PS-------LI 366

  Fly   390 TAGSYITL-LKTF 401
            .||:||.| |:||
  Fly   367 YAGNYIALSLETF 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 46/196 (23%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 54/208 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.