DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJC4 and CG14650

DIOPT Version :10

Sequence 1:NP_001294909.1 Gene:DNAJC4 / 3338 HGNCID:5271 Length:249 Species:Homo sapiens
Sequence 2:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster


Alignment Length:107 Identity:22/107 - (20%)
Similarity:44/107 - (41%) Gaps:25/107 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    36 YELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLR 100
            |.:|||.|.:|.|::::.:...:..:|||::. .......|..|..|:.::...::|..||..:.
  Fly   710 YSILGVPPDSSQEQIRKHYKKIAVLVHPDKNK-QAGAEEAFKVLQRAFELIGEPENRLIYDQSIA 773

Human   101 SGSPPKSPRTTVHDKSAHQTHSSSWTPPNAQYWSQFHSVRPQ 142
            .         |:|.:.|               |::.|.:..|
  Fly   774 E---------TLHTEKA---------------WTELHDLLSQ 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJC4NP_001294909.1 DnaJ 34..96 CDD:395170 14/59 (24%)
CG14650NP_649473.1 DnaJ 708..769 CDD:395170 14/59 (24%)
Jiv90 800..891 CDD:464360
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.