DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJC4 and Csp

DIOPT Version :10

Sequence 1:NP_001294909.1 Gene:DNAJC4 / 3338 HGNCID:5271 Length:249 Species:Homo sapiens
Sequence 2:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster


Alignment Length:62 Identity:19/62 - (30%)
Similarity:38/62 - (61%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    36 YELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDD 97
            ||:||:...|:.:::|:.:...:.:.|||::|.|.....:|.|::.|:.:||.:..|..||:
  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDN 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJC4NP_001294909.1 DnaJ 34..96 CDD:395170 17/59 (29%)
CspNP_730713.1 DnaJ 17..79 CDD:395170 17/59 (29%)

Return to query results.
Submit another query.